PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6KG379800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 264aa    MW: 30449 Da    PI: 8.8805
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6KG379800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.61.2e-31959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Pavir.6KG379800.1.p  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                         79***********************************************96 PP

2K-box47.86.1e-1781132556
                K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeq 56 
                          s ++ e+++ +s+++e+ kLk+++enLqr+qR+llGedL++L++keL++Le+
  Pavir.6KG379800.1.p  81 SLQNRESEQLKSSRNEYLKLKARVENLQRTQRNLLGEDLDTLDIKELERLEK 132
                          5566789999*****************************************8 PP

3K-box20.91.5e-0816619769100
                K-box  69 KnellleqieelqkkekelqeenkaLrkklee 100
                          +++++++q+ elq+kek+ +e+nk+Lr+klee
  Pavir.6KG379800.1.p 166 QTQHMVDQLTELQRKEKMFSEANKCLRRKLEE 197
                          79***************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.389161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
CDDcd002652.15E-44277No hitNo description
SuperFamilySSF554556.93E-34290IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-323859IPR002100Transcription factor, MADS-box
PfamPF014867.3E-1186132IPR002487Transcription factor, K-box
PROSITE profilePS512979.40490201IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST  60
QSMPKTLEKY QKCSYAGPET SLQNRESEQL KSSRNEYLKL KARVENLQRT QRNLLGEDLD  120
TLDIKELERL EKSTRVLKIL KVSTSYKCIF CELCVAPGIL KWYVSQTQHM VDQLTELQRK  180
EKMFSEANKC LRRKLEESNQ VIWQQAWEHG EPQQEVQHQL HGGNGFFHPL DAAHGEPTLQ  240
IGYPSEALPS SCMTTSFLPP WLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20186183Myocyte-specific enhancer factor 2B
1tqe_Q2e-20186183Myocyte-specific enhancer factor 2B
1tqe_R2e-20186183Myocyte-specific enhancer factor 2B
1tqe_S2e-20186183Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306921e-147AJ430692.1 Zea mays mRNA for putative MADS-domain transcription factor (m6 gene).
GenBankBT0333601e-147BT033360.1 Zea mays full-length cDNA clone ZM_BFb0092L03 mRNA, complete cds.
GenBankBT0426051e-147BT042605.1 Zea mays full-length cDNA clone ZM_BFb0367C04 mRNA, complete cds.
GenBankEU9598671e-147EU959867.1 Zea mays clone 220179 SRF-type transcription factor family protein mRNA, complete cds.
GenBankEU9607111e-147EU960711.1 Zea mays clone 227805 SRF-type transcription factor family protein mRNA, complete cds.
GenBankKJ7269251e-147KJ726925.1 Zea mays clone pUT3470 MADS transcription factor (MADS6) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974003.11e-143PREDICTED: MADS-box transcription factor 7-like
SwissprotP0C5B01e-135MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4661e-135MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLQ84V701e-137Q84V70_MAIZE; MADS transcription factor
STRINGGRMZM2G159397_P011e-137(Zea mays)
STRINGSi013937m1e-136(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34833469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.12e-81MIKC_MADS family protein